PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G15460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 306aa    MW: 34342.8 Da    PI: 7.3368
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G15460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA24.24.8e-08157183129
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGly 29 
                      Cs C +++Tp+W +gp+g++  CnaC l+
  LPERR12G15460.1 157 CSYCLSSQTPQWWKGPEGPT--CNACRLR 183
                      9*******************..*****98 PP

2GATA52.94.9e-17236270135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  LPERR12G15460.1 236 CTHCMSYKTPQWRTGPLGPKTLCNACGVRFKSGRL 270
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-4151200IPR000679Zinc finger, GATA-type
PROSITE profilePS501149.486151204IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.28E-5152186No hitNo description
Gene3DG3DSA:3.30.50.102.6E-6155186IPR013088Zinc finger, NHR/GATA-type
PfamPF003203.3E-6157183IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.24230266IPR000679Zinc finger, GATA-type
SMARTSM004013.3E-14230284IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-13234293No hitNo description
Gene3DG3DSA:3.30.50.106.0E-13235268IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.30E-12235292No hitNo description
PROSITE patternPS003440236261IPR000679Zinc finger, GATA-type
PfamPF003209.4E-15236270IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MDVHPPNAAA SSLGDFFPHE ESDGSGVEWL SVYVEDCLST SASCTNPLSA ELAPIKMASQ  60
GAAKPKLPPR SSSNPRKRKR SLASVISDTD DQQCITLFVE PPLLLLDHKD WLAESELILP  120
KKDKDEELVQ QQEQDEEEDY KVSAGMQFQE EQPVITCSYC LSSQTPQWWK GPEGPTCNAC  180
RLRIEAGNGI TTIGKKRYGQ AIDREQDMGN QRDRKKTKKA VYMNDELPPE EPVKRCTHCM  240
SYKTPQWRTG PLGPKTLCNA CGVRFKSGRL LPEYRPANSP TYVSDIHSNS HKKVMQLRQS  300
VSYPRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1014210.0AK101421.1 Oryza sativa Japonica Group cDNA clone:J033038C04, full insert sequence.
GenBankEU8470160.0EU847016.1 Oryza sativa Japonica Group clone KCS030C12 GATA zinc finger protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618342.10.0PREDICTED: uncharacterized protein LOC4352838
TrEMBLA0A0D9Y1A80.0A0A0D9Y1A8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA037833-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os12g42970.10.0(Oryza sativa Japonica Group)
STRINGORGLA12G0166900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.17e-35GATA transcription factor 2